A7335
PAX7 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7335
- Additional Names:
- CMYP19|HUP1|MYOSCO|PAX7|PAX7B|RMS2
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLV
- Uniprot:
- P23759
- Synonyms:
- HUP1;MYOSCO;paired box homeotic gene 7;paired box protein Pax-7;paired domain gene 7;PAX7 transcriptional factor;PAX7B;RMS2
- Extra Details:
- This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice