A7330
Ku70 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7330
- Additional Names:
- CTC75|CTCBF|G22P1|KU70|ML8|TLAA
- Application:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
- Uniprot:
- P12956
- Synonyms:
- 5'-deoxyribose-5-phosphate lyase Ku70;5'-dRP lyase Ku70;70 kDa subunit of Ku antigen;ATP-dependent DNA helicase 2 subunit 1;ATP-dependent DNA helicase II 70 kDa subunit;ATP-dependent DNA helicase II, 70 kDa subunit;CTC box binding factor 75 kDa subunit;CTC box-binding factor 75 kDa subunit;CTC75;CTCBF;DNA repair protein XRCC6;G22P1;Ku autoantigen p70 subunit;Ku autoantigen, 70kDa;KU70;lupus Ku autoantigen protein p70;ML8;thyroid autoantigen 70kD (Ku antigen);thyroid autoantigen 70kDa (Ku antigen);Thyroid-lupus autoantigen;thyroid-lupus autoantigen p70;TLAA;X-ray repair complementing defective repair in Chinese hamster cells 6;X-ray repair cross-complementing protein 6
- Extra Details:
- The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
- Shipping Conditions:
- Blue Ice








