A7328
EPHA1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7328
- Additional Names:
- EPH|EPHA1|EPHT|EPHT1
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNGTPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKETFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRGLYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGT
- Uniprot:
- P21709
- Synonyms:
- EPH;EPH tyrosine kinase;eph tyrosine kinase 1;ephrin type-A receptor 1;EPHT;EPHT1;erythropoietin-producing hepatoma amplified sequence;erythropoietin-producing hepatoma receptor;hEpha1;oncogene EPH;soluble EPHA1 variant 1;soluble EPHA1 variant 2;tyrosine-protein kinase receptor EPH
- Extra Details:
- This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene is expressed in some human cancer cell lines and has been implicated in carcinogenesis.
- Shipping Conditions:
- Blue Ice