Kallistatin (SERPINA4) Rabbit polyclonal antibody

Size

£152.00

SKU:: A7320
Additional Names:: KAL|kallistatin|Kallistatin (SERPINA4)|KLST|KST|PI-4|PI4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP
Uniprot:: P29622
Synonyms:: KAL;kallikrein inhibitor;kallistatin;KLST;KST;peptidase inhibitor 4;PI-4;PI4;protease inhibitor 4 (kallistatin);serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4;serpin A4;serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4;sserpin family A member 4;testicular secretory protein Li 22
Extra Details:: Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Located in extracellular exosome. Biomarker of diabetic retinopathy.