A7303
RUNX3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7303
- Additional Names:
- AML2|CBFA3|PEBP2aC|RUNX3
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 49kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
- Uniprot:
- Q13761
- Synonyms:
- acute myeloid leukemia 2 protein;acute myeloid leukemia gene 2;AML2;CBF-alpha-3;CBFA3;core-binding factor subunit alpha-3;core-binding factor, runt domain, alpha subunit 3;oncogene AML-2;PEA2 alpha C;PEBP2 alpha C;PEBP2aC;polyomavirus enhancer-binding protein 2 alpha C subunit;runt related transcription factor 3;runt-related transcription factor 3;SL3-3 enhancer factor 1 alpha C subunit;SL3/AKV core-binding factor alpha C subunit;transcription factor AML2
- Extra Details:
- This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice



