A7301
RNF7 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7301
- Additional Names:
- CKBBP1|rbx2|RNF7|ROC2|SAG
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
- Uniprot:
- Q9UBF6
- Synonyms:
- CKBBP1;CKII beta-binding protein 1;rbx2;regulator of cullins 2;RING finger protein 7;RING-box protein 2;ROC2;SAG;sensitive to apoptosis gene protein;sensitive to apoptosis, zinc RING finger protein SAG, regulator of cullins 2;zinc RING finger protein SAG
- Extra Details:
- The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Shipping Conditions:
- Blue Ice

