NGFRAP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7296
Additional Names:: Bex|DXS6984E|HGR74|NADE|NGFRAP1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 24kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
Uniprot:: Q00994
Synonyms:: Bex;brain-expressed X-linked protein 3;DXS6984E;HGR74;NADE;nerve growth factor receptor (TNFRSF16) associated protein 1;Nerve growth factor receptor-associated protein 1;NGFRAP1;ovarian granulosa cell 13.0 kDa protein HGR74;p75NTR-associated cell death executor;protein BEX3
Extra Details:: Enables identical protein binding activity. Predicted to be involved in signal transduction. Predicted to act upstream of or within extrinsic apoptotic signaling pathway via death domain receptors. Located in cytosol.