A Alpha-Smooth Muscle Actin (ACTA2) Rabbit polyclonal antibody

Size

£152.00

SKU:: A7248
Additional Names:: ACTSA|A Alpha-Smooth Muscle Actin (ACTA2)
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 42kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP
Uniprot:: P62736
Synonyms:: actin, alpha 2, smooth muscle, aorta;actin, aortic smooth muscle;ACTSA;Alpha-actin-2;alpha-cardiac actin;cell growth-inhibiting gene 46 protein
Extra Details:: This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.