A7247
ATR Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7247
- Additional Names:
- ATR|FCTCS|FRP1|MEC1|SCKL|SCKL1
- Application:
- ELISA, WB
- Molecular Weight:
- 301 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLE
- Uniprot:
- Q13535
- Synonyms:
- ataxia telangiectasia and Rad3-related protein;FCTCS;FRAP-related protein 1;FRAP-related protein-1;FRP1;MEC1;MEC1, mitosis entry checkpoint 1, homolog;SCKL;SCKL1;serine/threonine-protein kinase ATR
- Extra Details:
- The protein encoded by this gene is a serine/threonine kinase and DNA damage sensor, activating cell cycle checkpoint signaling upon DNA stress. The encoded protein can phosphorylate and activate several proteins involved in the inhibition of DNA replication and mitosis, and can promote DNA repair, recombination, and apoptosis. This protein is also important for fragile site stability and centrosome duplication. Defects in this gene are a cause of Seckel syndrome 1.
- Shipping Conditions:
- Blue Ice

