UIMC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7244
Additional Names:: RAP80|UIMC1|X2HRIP110
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 120kDa/100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDS
Uniprot:: Q96RL1
Synonyms:: BRCA1-A complex subunit RAP80;RAP80;receptor-associated protein 80;retinoid X receptor-interacting protein 110;Ubiquitin interaction motif-containing protein 1;X2HRIP110
Extra Details:: This gene encodes a nuclear protein that interacts with Brca1 (breast cancer 1) in a complex to recognize and repair DNA lesions. This protein binds ubiquitinated lysine 63 of histone H2A and H2AX. This protein may also function as a repressor of transcription. Alternative splicing results in multiple transcript variants.