A7243
POLD3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7243
- Additional Names:
- P66|P68|POLD3|PPP1R128
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 51kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKGNMMSNFFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
- Uniprot:
- Q15054
- Synonyms:
- DNA polymerase delta subunit 3;DNA polymerase delta subunit C;DNA polymerase delta subunit p66;DNA polymerase delta subunit p68;P66;P68;Pol delta C subunit (p66);polymerase (DNA-directed), delta 3, accessory subunit;polymerase (DNA) delta 3, accessory subunit;PPP1R128;protein phosphatase 1, regulatory subunit 128
- Extra Details:
- This gene encodes the 66-kDa subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein plays a role in regulating the activity of DNA polymerase delta through interactions with other subunits and the processivity cofactor proliferating cell nuclear antigen (PCNA). Alternatively spliced transcript variants have been observed for this gene.
- Shipping Conditions:
- Blue Ice