A7231
GJA5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7231
- Additional Names:
- ATFB11|CX40|GJA5
- Application:
- ELISA, WB
- Molecular Weight:
- 40kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- ABP:
- No Import Docs
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
- Uniprot:
- P36382
- Synonyms:
- ATFB11;connexin 40;Connexin-40;CX40;gap junction alpha-5 protein;gap junction protein alpha 5 40kDa
- Extra Details:
- This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encoding the same isoform have been described.
- Shipping Conditions:
- Blue Ice