A7224
TP53AIP1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7224
- Additional Names:
- P53AIP1|TP53AIP1
- Application:
- ELISA, WB
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
- Uniprot:
- Q9HCN2
- Synonyms:
- p53-regulated apoptosis-inducing protein 1;P53AIP1
- Extra Details:
- This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice