TOB2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7223
Additional Names:: APRO5|TOB2|TOB4|TOBL|TROB2
Application:: ELISA, WB, IHC-P
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVEL
Uniprot:: Q14106
Synonyms:: APRO5;protein Tob2;protein Tob4;TOB4;TOBL;transducer of erbB-2 2;TROB2
Extra Details:: TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.