A7188
GTF2H3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7188
- Additional Names:
- BTF2|GTF2H3|P34|TFB4|TFIIH
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 36 kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
- Uniprot:
- Q13889
- Synonyms:
- basic transcription factor 2 34 kDa subunit;BTF2;General transcription factor IIH polypeptide 3;general transcription factor IIH subunit 3;general transcription factor IIH, polypeptide 3, 34kDa;P34;TFB4;TFIIH;TFIIH basal transcription factor complex p34 subunit
- Extra Details:
- This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision repair and associates with the Cdk-activating kinase complex. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 14.
- Shipping Conditions:
- Blue Ice