ELF5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7181
Additional Names:: ELF5|ESE2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 31kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
ABP:: No Import Docs
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSN
Uniprot:: Q9UKW6
Synonyms:: E74-like factor 5;E74-like factor 5 (ets domain transcription factor);epithelium-restricted ESE-1-related Ets factor;epithelium-specific Ets transcription factor 2;ESE2;ETS-related transcription factor Elf-5
Extra Details:: This gene encodes an epithelium-specific ETS family transcription factor. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. This gene has been implicated as a tumor suppressive transcription factor in breast cancer.