Septin 2 Rabbit monoclonal antibody

Size

POA

SKU:: A7163
Additional Names:: DIFF6|hNedd5|NEDD-5|NEDD5|Pnutl3|SEPT2|Septin 2
Application:: ELISA, WB
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYEN
Uniprot:: Q15019
Synonyms:: DIFF6;epididymis secretory sperm binding protein;hNedd5;NEDD-5;NEDD5;Neural precursor cell expressed developmentally down-regulated protein 5;neural precursor cell expressed, developmentally down-regulated 5;Pnutl3;SEPT2;septin-2
Extra Details:: Enables identical protein binding activity. Predicted to be involved in several processes, including cilium assembly; regulation of exocytosis; and smoothened signaling pathway. Predicted to act upstream of or within regulation of L-glutamate import across plasma membrane and regulation of protein localization. Located in several cellular components, including cytoskeleton; photoreceptor connecting cilium; and sperm annulus. Part of septin complex.