A7153
NCR3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7153
- Additional Names:
- 1C7|CD337|LY117|MALS|NCR3|NKp30
- Application:
- ELISA, WB
- Molecular Weight:
- 22kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
- Uniprot:
- O14931
- Synonyms:
- 1C7;activating natural killer receptor p30;activating NK-A1 receptor;CD337;LY117;lymphocyte antigen 117;MALS;natural cytotoxicity triggering receptor 3;natural killer cell p30-related protein;NK-p30;NKp30
- Extra Details:
- The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice