A7134
WDR77 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7134
- Additional Names:
- HKMT1069|MEP-50|MEP50|Nbla10071|p44|p44/Mep50|WDR77
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTK
- Uniprot:
- Q9BQA1
- Synonyms:
- androgen receptor cofactor p44;HKMT1069;MEP-50;MEP50;methylosome protein 50;Nbla10071;p44;p44/Mep50;testis tissue sperm-binding protein Li 44a;WD repeat-containing protein 77
- Extra Details:
- The protein encoded by this gene is an androgen receptor coactivator that forms a complex with protein arginine methyltransferase 5, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. The encoded protein may be involved in the early stages of prostate cancer, with most of the protein being nuclear-localized in benign cells but cytoplasmic in cancer cells. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice





