A7128
ELAC2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7128
- Additional Names:
- COXPD17|ELAC2|ELC2|HPC2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 105kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MWALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKLKVARLDNIFLTRMHWSNVGGLSGMILTLKETGLPKCVLSGPPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYEDETMTVYQIPIHSEQRRGKHQPWQSPERPLSRLSPERSSDSESNENEPHLPHGVSQRRGVRDSSLVVAFICKLHLKRGNFLVLKAKEMGLPVGTAA
- Uniprot:
- Q9BQ52
- Synonyms:
- COXPD17;elaC homolog 2;elaC homolog protein 2;elaC-like protein 2;ELC2;heredity prostate cancer protein 2;HPC2;putative prostate cancer susceptibility protein HPC2/ELAC2;ribonuclease Z 2;RNase Z 2;tRNA 3 endonuclease 2;tRNase Z (long form);tRNase Z 2;zinc phosphodiesterase ELAC protein 2
- Extra Details:
- The protein encoded by this gene has a C-terminal domain with tRNA 3′ processing endoribonuclease activity, which catalyzes the removal of the 3' trailer from precursor tRNAs. The protein also interacts with activated Smad family member 2 (Smad2) and its nuclear partner forkhead box H1 (also known as FAST-1), and reduced expression can suppress transforming growth factor-beta induced growth arrest. Mutations in this gene result in an increased risk of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice







