A7112
NDE1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7112
- Additional Names:
- HOM-TES-87|LIS4|MHAC|NDE|NDE1|NUDE|NUDE1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 39kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQL
- Uniprot:
- Q9NXR1
- Synonyms:
- epididymis secretory sperm binding protein;HOM-TES-87;LIS1-interacting protein NUDE1, rat homolog;LIS4;MHAC;NDE;nuclear distribution protein nudE homolog 1;NUDE;nudE nuclear distribution E homolog 1;nudE nuclear distribution gene E homolog 1;NUDE1
- Extra Details:
- This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice