A7097
NFU1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7097
- Additional Names:
- CGI-33|HIRIP|HIRIP5|MMDFS|MMDS1|Nfu|NFU1|NifU|NIFUC
- Application:
- ELISA, WB
- Molecular Weight:
- 25-28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQF
- Uniprot:
- Q9UMS0
- Synonyms:
- CGI-33;HIRA-interacting protein 5;HIRIP;HIRIP5;iron-sulfur cluster scaffold protein;MMDS1;Nfu;NFU1 iron-sulfur cluster scaffold homolog, mitochondrial;NifU;NifU-like C-terminal domain containing;NIFUC
- Extra Details:
- This gene encodes a protein that is localized to mitochondria and plays a critical role in iron-sulfur cluster biogenesis. The encoded protein assembles and transfers 4Fe-4S clusters to target apoproteins including succinate dehydrogenase and lipoic acid synthase. Mutations in this gene are a cause of multiple mitochondrial dysfunctions syndrome-1, and pseudogenes of this gene are located on the short arms of chromosomes 1 and 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice