MTF2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7077
Additional Names:: dJ976O13.2|M96|MTF2|PCL2|TDRD19A
Application:: ELISA, WB
Molecular Weight:: 67kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLE
Uniprot:: Q9Y483
Synonyms:: dJ976O13.2;hPCl2;M96;metal regulatory transcription factor 2;metal-response element DNA-binding protein M96;metal-response element-binding transcription factor 2;PCL2;polycomb-like 2;polycomb-like protein 2;putative DNA binding protein;TDRD19A;tudor domain containing 19A
Extra Details:: Enables methylated histone binding activity and transcription corepressor binding activity. Predicted to be involved in several processes, including regulation of histone H3-K27 methylation; regulation of transcription by RNA polymerase II; and segment specification. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Located in cytoplasm; focal adhesion; and nucleoplasm.