A7071
MORF4L1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7071
- Additional Names:
- Eaf3|FWP006|HsT17725|MEAF3|MORF4L1|MORFRG15|MRG15|S863-6
- Application:
- ELISA, WB
- Molecular Weight:
- 41kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
- Uniprot:
- Q9UBU8
- Synonyms:
- Eaf3;Esa1p-associated factor 3 homolog;FWP006;HsT17725;MEAF3;MORF-related gene 15 protein;MORF-related gene on chromosome 15;MORFRG15;mortality factor 4-like protein 1;MRG15;protein MSL3-1;S863-6;transcription factor-like protein MRG15
- Extra Details:
- Enables protein N-terminus binding activity. Involved in double-strand break repair via homologous recombination and histone modification. Located in nuclear speck. Part of NuA4 histone acetyltransferase complex and Sin3 complex.
- Shipping Conditions:
- Blue Ice