PLK2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7066
Additional Names:: hPlk2|hSNK|PLK2|SNK
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 78kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQ
Uniprot:: Q9NYY3
Synonyms:: hPlk2;hSNK;PLK-2;Polo-like kinase 2;serine/threonine-protein kinase PLK2;serine/threonine-protein kinase SNK;serum-inducible kinase;SNK
Extra Details:: The protein encoded by this gene is a member of the polo family of serine/threonine protein kinases that have a role in normal cell division. This gene is most abundantly expressed in testis, spleen and fetal tissues, and its expression is inducible by serum, suggesting that it may also play an important role in cells undergoing rapid cell division. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.