A7044
HAND2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7044
- Additional Names:
- bHLHa26|dHand|DHAND2|HAND2|Hed|Thing2
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 26 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
- Uniprot:
- P61296
- Synonyms:
- basic helix-loop-helix transcription factor HAND2;bHLHa26;class A basic helix-loop-helix protein 26;deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2;dHand;DHAND2;heart- and neural crest derivatives-expressed protein 2;Hed;Thing2
- Extra Details:
- The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development.
- Shipping Conditions:
- Blue Ice





_IHC_01.jpg)
_IHC_02.jpg)
_IHC_03.jpg)