HAND2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7044
Additional Names:: bHLHa26|dHand|DHAND2|HAND2|Hed|Thing2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 26 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Uniprot:: P61296
Synonyms:: basic helix-loop-helix transcription factor HAND2;bHLHa26;class A basic helix-loop-helix protein 26;deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2;dHand;DHAND2;heart- and neural crest derivatives-expressed protein 2;Hed;Thing2
Extra Details:: The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development.