COPS2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7037
Additional Names:: ALIEN|COPS2|CSN2|SGN2|TRIP15
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 52kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILA
Uniprot:: P61201
Synonyms:: ALIEN;alien homolog;COP9 constitutive photomorphogenic homolog subunit 2;COP9 signalosome complex subunit 2;CSN2;JAB1-containing signalosome subunit 2;SGN2;signalosome subunit 2;thyroid receptor-interacting protein 15;TR-interacting protein 15;TRIP-15;TRIP15
Extra Details:: Predicted to enable transcription corepressor activity. Involved in protein deneddylation and protein phosphorylation. Located in cytoplasm. Part of COP9 signalosome.