A7031
USP8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7031
- Additional Names:
- HumORF8|PITA4|SPG59|UBPY|USP8
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 140kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQI
- Uniprot:
- P40818
- Synonyms:
- deubiquitinating enzyme 8;HumORF8;PITA4;SPG59;ubiquitin carboxyl-terminal hydrolase 8;ubiquitin isopeptidase Y;Ubiquitin thioesterase 8;ubiquitin thiolesterase 8;ubiquitin-specific-processing protease 8;UBPY
- Extra Details:
- This gene encodes a protein that belongs to the ubiquitin-specific processing protease family of proteins. The encoded protein is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage. This protein is required for the cell to enter the S phase of the cell cycle and also functions as a positive regulator in the Hedgehog signaling pathway in development. Pseudogenes of this gene are present on chromosomes 2 and 6. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice



