AP3B1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7019
Additional Names:: ADTB3|ADTB3A|AP3B1|HPS|HPS2|PE
Application:: ELISA, WB, IHC-P
Molecular Weight:: 132kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGSITVSMGIDFCDSTQTASFQLCTKDDCFNVNIQPPVGELLLPVAMSEKDFKKEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG
Uniprot:: O00203
Synonyms:: adaptor protein complex AP-3 subunit beta-1;adaptor related protein complex 3 beta 1 subunit;Adaptor-related protein complex 3 subunit beta-1;ADTB3;ADTB3A;AP-3 complex beta-3A subunit;AP-3 complex subunit beta-1;beta-3A;beta-3A-adaptin;clathrin assembly protein complex 3 beta-1 large chain;HPS;HPS2;PE
Extra Details:: This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. Two transcript variants encoding different isoforms have been found for this gene.