ZNF148 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7001
Additional Names:: BERF-1|BFCOL1|GDACCF|HT-BETA|pHZ-52|ZBP-89|ZFP148|ZNF148
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 105kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG
Uniprot:: Q9UQR1
Synonyms:: BERF-1;BFCOL1;CACCC box-binding protein;CLL-associated antigen KW-10;GDACCF;HT-BETA;pHZ-52;transcription factor ZBP-89;ZBP-89;ZFP148;zinc finger DNA-binding protein 89;zinc finger protein 148
Extra Details:: The protein encoded by this gene is a member of the Kruppel family of zinc finger DNA binding proteins. The encoded protein activates transcription of the T-cell receptor and intestinal alkaline phosphatase genes but represses transcription of the ornithine decarboxylase, vimentin, gastrin, stomelysin, and enolase genes. Increased expression of this gene results in decreased patient survival rates from colorectal cancer, while mutations in this gene have been associated with global developmental delay, hypoplastic corpus callosum, and dysmorphic facies.