A6981
SLC1A5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6981
- Additional Names:
- AAAT|ASCT2|ATBO|M7V1|M7VS1|R16|RDRC|SLC1A5
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQ
- Uniprot:
- Q15758
- Synonyms:
- AAAT;ASCT2;ATB(0);ATBO;baboon M7 virus receptor;M7V1;M7VS1;neutral amino acid transporter B;neutral amino acid transporter B(0);R16;RD114 virus receptor;RD114/simian type D retrovirus receptor;RDRC;sodium-dependent neutral amino acid transporter type 2;solute carrier family 1 (neutral amino acid transporter), member 5;Solute carrier family 1 member 5
- Extra Details:
- The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [PubMed 11781704]).
- Shipping Conditions:
- Blue Ice

