A6971
RORA Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6971
- Additional Names:
- IDDECA|NR1F1|ROR1|ROR2|ROR3|RORA|RORa1|RORalpha|RZR-ALPHA|RZRA
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
- Uniprot:
- P35398
- Synonyms:
- IDDECA;NR1F1;nuclear receptor ROR-alpha;nuclear receptor RZR-alpha;nuclear receptor subfamily 1 group F member 1;RAR-related orphan receptor A;retinoic acid receptor-related orphan receptor alpha;retinoid-related orphan receptor alpha;Retinoid-related orphan receptor-alpha;ROR-alpha;ROR1;ROR2;ROR3;RZR-ALPHA;RZRA;thyroid hormone nuclear receptor alpha variant 4;transcription factor RZR-alpha
- Extra Details:
- The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice

