PTPRO Rabbit polyclonal antibody

Size

£152.00

SKU:: A6958
Additional Names:: GLEPP1|NPHS6|PTP-OC|PTP-U2|PTPRO|PTPROT|PTPU2|R-PTP-O
Application:: ELISA, WB
Molecular Weight:: 138kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWW
Uniprot:: Q16827
Synonyms:: GLEPP1;glomerular epithelial protein 1;NPHS6;osteoclastic transmembrane protein-tyrosine phosphatase;phosphotyrosine phosphatase U2;protein tyrosine phosphatase PTP-U2;Protein tyrosine phosphatase U2;PTP phi;PTP-OC;PTP-U2;PTPase U2;PTPROT;PTPU2;R-PTP-O;receptor-type tyrosine-protein phosphatase O
Extra Details:: This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer.

Shipping Conditions:: Blue Ice