Cyclophilin 40 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6949
Additional Names:: Cyclophilin 40|CYP-40|CYPD
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 41kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA
Uniprot:: Q08752
Synonyms:: 40 kDa peptidyl-prolyl cis-trans isomerase;40 kDa peptidyl-prolyl cis-trans isomerase D;cyclophilin 40;cyclophilin D;Cyclophilin-40;cyclophilin-related protein;CYP-40;CYPD;peptidyl-prolyl cis-trans isomerase D;PPIase D;rotamase D;testicular tissue protein Li 147
Extra Details:: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.