LSS Rabbit polyclonal antibody

Size

£152.00

SKU:: A6930
Additional Names:: APMR4|CTRCT44|HYPT14|LSS|OSC
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLPAGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNILHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYLPMSYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNVAPDELYTPHSWLLRVVYALL
Uniprot:: P48449
Synonyms:: 2,3-epoxysqualene--lanosterol cyclase;2,3-epoxysqualene-lanosterol cyclase;APMR4;CTRCT44;epididymis secretory sperm binding protein;hOSC;HYPT14;lanosterol synthase;lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase);OSC;oxidosqualene--lanosterol cyclase
Extra Details:: The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Alternative splicing results in multiple transcript variants encoding different isoforms.