A6928
KLRB1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6928
- Additional Names:
- CD161|CLEC5B|hNKR-P1A|KLRB1|NKR|NKR-P1|NKR-P1A|NKRP1A
- Application:
- ELISA, WB
- Molecular Weight:
- 30 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
- Uniprot:
- Q12918
- Synonyms:
- C-type lectin domain family 5 member B;CD161;CLEC5B;hNKR-P1A;killer cell lectin-like receptor subfamily B member 1;killer cell lectin-like receptor subfamily B, member 1;natural killer cell surface protein P1A;NKR;NKR-P1;NKR-P1A;NKRP1A
- Extra Details:
- Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein is classified as a type II membrane protein because it has an external C terminus.
- Shipping Conditions:
- Blue Ice

