A6927
KCND3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6927
- Additional Names:
- BRGDA9|KCND3|KCND3L|KCND3S|KSHIVB|KV4.3|SCA19|SCA22
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 73kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
- Uniprot:
- Q9UK17
- Synonyms:
- BRGDA9;KCND3L;KCND3S;KSHIVB;KV4.3;potassium channel, voltage gated Shal related subfamily D, member 3;potassium ionic channel Kv4.3;potassium voltage-gated channel long;potassium voltage-gated channel subfamily D member 3;potassium voltage-gated channel, Shal-related subfamily, member 3;SCA19;SCA22;sha1-related potassium channel Kv4.3;voltage-gated K+ channel;voltage-gated potassium channel subunit Kv4.3
- Extra Details:
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene.
- Shipping Conditions:
- Blue Ice



