A6907
FKBP3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6907
- Additional Names:
- FKBP-25|FKBP-3|FKBP25|FKBP3|PPIase
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
- Uniprot:
- Q00688
- Synonyms:
- 25 kDa FK506-binding protein;25 kDa FKBP;FK506 binding protein 3, 25kDa;FK506-binding protein 25, T-cell;FK506-binding protein 3;FKBP-25;FKBP-3;FKBP25;immunophilin FKBP25;peptidyl-prolyl cis-trans isomerase FKBP3;PPIase;PPIase FKBP3;rapamycin binding protein;rapamycin-selective 25 kDa immunophilin;rotamase
- Extra Details:
- The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
- Shipping Conditions:
- Blue Ice