A6884
ERCC8 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6884
- Additional Names:
- CKN1|CSA|ERCC8|UVSS2
- Application:
- ELISA, WB
- Molecular Weight:
- 44kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
- Uniprot:
- Q13216
- Synonyms:
- CKN1;cockayne syndrome WD repeat protein CSA;Cockayne syndrome WD-repeat protein CSA;CSA;DNA excision repair protein ERCC-8;excision repair cross-complementation group 8;excision repair cross-complementing rodent repair deficiency, complementation group 8;UVSS2
- Extra Details:
- This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice