AMY1A Rabbit polyclonal antibody

Size

£152.00

SKU:: A6867
Additional Names:: AMY1|AMY1A
Application:: ELISA, WB
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNH
Uniprot:: P04745
Synonyms:: 1,4-alpha-D-glucan glucanohydrolase 1;alpha-amylase 1;alpha-amylase 1A;alpha-amylase 1B;alpha-amylase 1C;AMY1;amylase alpha 1A (salivary);amylase alpha 1B (salivary);amylase alpha 1C (salivary);amylase, salivary, alpha-1A;amylase, salivary, alpha-1B;amylase, salivary, alpha-1C;glycogenase;salivary alpha-amylase;salivary amylase alpha 1A;salivary amylase alpha 1B;salivary amylase alpha 1C
Extra Details:: Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein.

Shipping Conditions:: Blue Ice