ALPPL2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6866
Additional Names:: ALPPL|ALPPL2|GCAP
Application:: ELISA, WB
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS
Uniprot:: P10696
Synonyms:: alkaline phosphatase Nagao isozyme;alkaline phosphatase, germ cell type;alkaline phosphatase, placental like 2;alkaline phosphatase, placental-like;ALP-1;ALPPL;ALPPL2;GCAP;germ cell alkaline phosphatase;Nagao isozyme;Placental alkaline phosphatase-like;placental-like alkaline phosphatase;testicular and thymus alkaline phosphatase
Extra Details:: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.