ALOX15 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6864
Additional Names:: 12-LOX|15-LOX|15-LOX-1|ALOX15|LOG15
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGY
Uniprot:: P16050
Synonyms:: 12-LOX;12/15-lipoxygenase;15-lipooxygenase-1;15-lipoxygenase type 1;15-LOX;15-LOX type 1;15-LOX-1;arachidonate 12-lipoxygenase, leukocyte-type;arachidonate omega-6 lipoxygenase;hepoxilin A3 synthase Alox15;linoleate 13S-lipoxygenase;LOG15;polyunsaturated fatty acid lipoxygenase ALOX15
Extra Details:: This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on various polyunsaturated fatty acid substrates to generate various bioactive lipid mediators such as eicosanoids, hepoxilins, lipoxins, and other molecules. The encoded enzyme and its reaction products have been shown to regulate inflammation and immunity. Multiple pseudogenes of this gene have been identified in the human genome.