A6863
AP2A1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6863
- Additional Names:
- ADTAA|AP2-ALPHA|AP2A1|CLAPA1
- Application:
- ELISA, WB
- Molecular Weight:
- 108kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASPDLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSASTDLQDYTYYFVPAPWLSVK
- Uniprot:
- O95782
- Synonyms:
- 100 kDa coated vesicle protein A;adapter-related protein complex 2 alpha-1 subunit;adapter-related protein complex 2 subunit alpha-1;adaptin, alpha A;adaptor protein complex AP-2 subunit alpha-1;adaptor related protein complex 2 alpha 1 subunit;Adaptor-related protein complex 2 subunit alpha-1;ADTAA;alpha-adaptin A;alpha1-adaptin;AP-2 complex subunit alpha-1;AP2-ALPHA;CLAPA1;clathrin assembly protein complex 2 alpha-A large chain;clathrin-associated/assembly/adaptor protein, large, alpha 1;plasma membrane adaptor HA2/AP2 adaptin alpha A subunit
- Extra Details:
- This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined.
- Shipping Conditions:
- Blue Ice