DGAT1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6857
Additional Names:: ARAT|ARGP1|DGAT|DGAT1|DIAR7
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA
Uniprot:: O75907
Synonyms:: ACAT related gene product 1;ACAT-related gene product 1;acyl coenzyme A:cholesterol acyltransferase related gene 1;acyl-CoA retinol O-fatty-acyltransferase;acyl-CoA:diacylglycerol acyltransferase;ARAT;ARGP1;DGAT;diacylglycerol O-acyltransferase 1;DIAR7;diglyceride acyltransferase
Extra Details:: This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases.