A6855
WRN Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6855
- Additional Names:
- RECQ3|RECQL2|RECQL3|WRN
- Application:
- ELISA, WB
- Molecular Weight:
- 200kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
- Uniprot:
- Q14191
- Synonyms:
- DNA helicase, RecQ-like type 3;exonuclease WRN;recQ protein-like 2;RECQ3;RECQL2;RECQL3;Werner syndrome ATP-dependent helicase;Werner syndrome RecQ like helicase;Werner syndrome, RecQ helicase-like
- Extra Details:
- This gene encodes a member of the RecQ subfamily of DNA helicase proteins. The encoded nuclear protein is important in the maintenance of genome stability and plays a role in DNA repair, replication, transcription and telomere maintenance. This protein contains a N-terminal 3' to 5' exonuclease domain, an ATP-dependent helicase domain and RQC (RecQ helicase conserved region) domain in its central region, and a C-terminal HRDC (helicase RNase D C-terminal) domain and nuclear localization signal. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by accelerated aging and an elevated risk for certain cancers.
- Shipping Conditions:
- Blue Ice