RECQL4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6846
Additional Names:: RECQ4|RECQL4
Application:: ELISA, WB
Molecular Weight:: 140kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA
Uniprot:: O94761
Synonyms:: ATP-dependent DNA helicase Q4;DNA helicase, RecQ-like type 4;DNA helicase, RecQ-like, type 4;RecQ helicase-like 4;RecQ protein-like 4;RECQ4;RTS
Extra Details:: The protein encoded by this gene is a DNA helicase that belongs to the RecQ helicase family. DNA helicases unwind double-stranded DNA into single-stranded DNAs and may modulate chromosome segregation. This gene is predominantly expressed in thymus and testis. Mutations in this gene are associated with Rothmund-Thomson, RAPADILINO and Baller-Gerold syndromes.