POLR2F Rabbit polyclonal antibody

Size

£152.00

SKU:: A6837
Additional Names:: HRBP14.4|POLR2F|POLRF|RPABC14.4|RPABC2|RPB14.4|RPB6|RPC15
Application:: ELISA, WB
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Uniprot:: P61218
Synonyms:: DNA-directed RNA polymerase II subunit F;DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide;DNA-directed RNA polymerases I, II, and III subunit RPABC2;HRBP14.4;POLRF;polymerase (RNA) II (DNA directed) polypeptide F;polymerase (RNA) II subunit F;RNA Polymerase II subunit 14.4 kD;RNA polymerase II subunit F;RNA polymerases I, II, and III subunit ABC2;RPABC14.4;RPABC2;RPB14.4;RPB6;RPB6 homolog;RPC15
Extra Details:: This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants.