A6834
POLD2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6834
- Additional Names:
- POLD2
- Application:
- ELISA, WB
- Molecular Weight:
- 51kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTL
- Uniprot:
- P49005
- Synonyms:
- DAN polymerase delta 2, accessory subunit;DNA polymerase delta subunit 2;DNA polymerase delta subunit p50;Pol delta B subunit (p50);polymerase (DNA directed), delta 2, accessory subunit;polymerase (DNA directed), delta 2, regulatory subunit 50kDa;polymerase (DNA) delta 2, accessory subunit
- Extra Details:
- This gene encodes the 50-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein is required for the stimulation of DNA polymerase delta activity by the processivity cofactor proliferating cell nuclear antigen (PCNA). Expression of this gene may be a marker for ovarian carcinomas. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5.
- Shipping Conditions:
- Blue Ice