LMO2 Rabbit monoclonal antibody

Size

POA

SKU:: A6832
Additional Names:: LMO-2|LMO2|RBTN2|RBTNL1|RHOM2|TTG2
Application:: ELISA, WB
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKR
Uniprot:: P25791
Synonyms:: cysteine-rich protein TTG-2;LIM domain only protein 2;LMO-2;RBTN2;RBTNL1;RHOM2;rhombotin-2;rhombotin-like 1;T-cell translocation gene 2;T-cell translocation protein 2;TTG2
Extra Details:: LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.