PDE5A Rabbit polyclonal antibody

Size

£152.00

SKU:: A6831
Additional Names:: CGB-PDE|CN5A|PDE5|PDE5A
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCS
Uniprot:: O76074
Synonyms:: CGB-PDE;cGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase;cGMP-binding cGMP-specific phosphodiesterase;cGMP-specific 3',5'-cyclic phosphodiesterase;cGMP-specific phosphodiesterase PDE5A2;cGMP-specific phosphodiesterase type 5A;CN5A;PDE5;phosphodiesterase 5A, cGMP-specific;phosphodiesterase isozyme 5
Extra Details:: This gene encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms.